{"product_id":"proteintech-28693-1-ap","title":"Proteintech, 28693-1-AP, SEC62 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEC62 (28693-1-AP) by Proteintech is a Polyclonal antibody targeting SEC62 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n28693-1-AP targets SEC62 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, SW480 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSEC62 is a integral endoplasmic reticulum (ER) membrane protein. SEC62 and SEC63 form a dimeric complex and play a central role in translocation of nascent and newly synthesized precursor polypeptides into the ER. SEC62 is associated with poor prognosis in a variety of tumors, such as  prostate cancer, hepatocellular cancer, breast cancer , melanoma, colorectal cancer (PMID: 36262254).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29932 Product name: Recombinant human SEC62 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of NM_003262 Sequence: MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKEEDKKSKKENIKDEKTKKEKEKKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLDGNE Predict reactive species\nFull Name: SEC62 homolog (S. cerevisiae)\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: NM_003262\nGene Symbol: SEC62\nGene ID (NCBI): 7095\nRRID: AB_3086078\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99442\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869761622185,"sku":"28693-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28693-1-ap","provider":"Iright","version":"1.0","type":"link"}