{"product_id":"proteintech-28694-1-ap","title":"Proteintech, 28694-1-AP, SP7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SP7 (28694-1-AP) by Proteintech is a Polyclonal antibody targeting SP7 in WB, ELISA applications with reactivity to human samples\n28694-1-AP targets SP7 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Saos-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSp7 is identified in several tissues, including bone, tooth, brain, and the reproductive tract (PMID: 11792318, 33135214, 36881265).  In bone, Sp7 is expressed at multiple stages throughout the mesenchymal bone lineage and plays different roles in different osteocytes (PMID: 36881265). SP7 regulates osteoblast differentiation and bone formation through osteoblast target genes by recognizing AT-rich region. In osteocytes, SP7 regulates osteocyte maturation and intracortical remodeling through osteocyte target genes by recognizing TGA(G\/T) TCA motif. SP7 also regulates chondrocyte differentiation and endochondral ossification (36881265).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29889 Product name: Recombinant human SP7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-179 aa of NM_152860 Sequence: MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSVGSDLSASKTMGDAYPAPFTSTNGLLSPAGSPPAPTSGYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQ Predict reactive species\nFull Name: Sp7 transcription factor\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: NM_152860\nGene Symbol: SP7\nGene ID (NCBI): 121340\nRRID: AB_3669667\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TDD2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869385642153,"sku":"28694-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28694-1-ap","provider":"Iright","version":"1.0","type":"link"}