{"product_id":"proteintech-28695-1-ap","title":"Proteintech, 28695-1-AP, KNL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KNL1 (28695-1-AP) by Proteintech is a Polyclonal antibody targeting KNL1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n28695-1-AP targets KNL1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKNL1 is a component of the multiprotein assembly that is required for creation of kinetochore-microtubule attachments and chromosome segregation. KNL1 functions as a scaffold for proteins that influence the spindle assembly checkpoint during the eukaryotic cell cycle and it interacts with at least five different kinetochore proteins and two checkpoint kinases. In adults, this gene is predominantly expressed in normal testes, various cancer cell lines and primary tumors from other tissues and is ubiquitously expressed in fetal tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29881 Product name: Recombinant human KNL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1746-1896 aa of NM_170589 Sequence: PDEINSSDSINIETEEKALIETYQKEISPYENKMGKTCNSQKRTWVQEEEDIHKEKKIRKNEIKFSDTTQDREIFDHHTEEDIDKSANSVLIKNLSRTPSSCSSSLDSIKADGTSLDFSTYRSSQMESQFLRDTICEESLREKLQDGRITI Predict reactive species\nFull Name: cancer susceptibility candidate 5\nCalculated Molecular Weight: 265 kDa\nObserved Molecular Weight: 300 kDa\nGenBank Accession Number: NM_170589\nGene Symbol: CASC5\/KNL1\nGene ID (NCBI): 57082\nRRID: AB_3086079\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NG31\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887699054761,"sku":"28695-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28695-1-ap","provider":"Iright","version":"1.0","type":"link"}