{"product_id":"proteintech-28706-1-ap","title":"Proteintech, 28706-1-AP, RALYL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RALYL (28706-1-AP) by Proteintech is a Polyclonal antibody targeting RALYL in WB, ELISA applications with reactivity to Human samples\n28706-1-AP targets RALYL in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRALY RNA binding protein-like (RALYL) belongs to the RALY subfamily. RALYL locates in 8q21.2, the function of which is RNA-binding and nucleotide binding. The RALYL high expression in the normal adrenal, kidney and brain (Shyamsundar et al., 2005). Furthermore, RALYL expression down-regulated correlates with mental disorder (Lee et al., 2007), Parkinson's disease (Moran et al., 2006), brain cancer (Maris et al., 2008), adrenal cancer (Giordano et al., 2009) and kidney cancer (Higgins et al., 2003). The expression of RALYL was significantly low in Clear Cell Renal Cell Carcinoma and correlated with a poor prognosis in a large number of clinical samples. Our findings showed that RALYL may be a potential therapeutic target as well as a poor prognostic\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30310 Product name: Recombinant human RALYL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 223-291 aa of BC031090 Sequence: QQKAEAEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK Predict reactive species\nFull Name: RALY RNA binding protein-like\nCalculated Molecular Weight: 291 aa, 32 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC031090\nGene Symbol: RALYL\nGene ID (NCBI): 138046\nRRID: AB_2881197\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86SE5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887779041449,"sku":"28706-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28706-1-ap","provider":"Iright","version":"1.0","type":"link"}