{"product_id":"proteintech-28747-1-ap","title":"Proteintech, 28747-1-AP, MDMX\/MDM4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MDMX\/MDM4 (28747-1-AP) by Proteintech is a Polyclonal antibody targeting MDMX\/MDM4 in WB, IHC, IP, ELISA applications with reactivity to human samples\n28747-1-AP targets MDMX\/MDM4 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A2780 cells, MCF-7 cells,  MDA-MB-231 cells,  U2OS cells\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: human ovary tumor tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMDM4 is also named as MDMX. It inhibits the activity of the tumor suppressor p53 by primarily cooperating with the p53 feedback regulator MDM2. MDM4 resides mostly in the cytoplasm, but can be recruited to the nucleus by MDM2.(PMID:16511572). The predicted mass of the protein is 54 kDa, while the observed mass is 70-80 kDa, a difference which stated is probably due to phosphorylation or other posttranslational modification(PMID:9226370, 28097652). It can be ubiquitinated and degraded by MDM2(PMID:16163388). It has 5 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30456 Product name: Recombinant human MDM4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 359-490 aa of BC067299 Sequence: VPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA Predict reactive species\nFull Name: Mdm4 p53 binding protein homolog (mouse)\nCalculated Molecular Weight: 490 aa, 55 kDa\nObserved Molecular Weight: 70-76 kDa\nGenBank Accession Number: BC067299\nGene Symbol: MDMX\/MDM4\nGene ID (NCBI): 4194\nRRID: AB_3086083\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15151\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869558788265,"sku":"28747-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28747-1-ap","provider":"Iright","version":"1.0","type":"link"}