{"product_id":"proteintech-28752-1-ap","title":"Proteintech, 28752-1-AP, MOG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MOG (28752-1-AP) by Proteintech is a Polyclonal antibody targeting MOG in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n28752-1-AP targets MOG in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat cerebellum tissue, mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30377 Product name: Recombinant human MOG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-154 aa of BC035938 Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG Predict reactive species\nFull Name: myelin oligodendrocyte glycoprotein\nCalculated Molecular Weight: 295 aa, 34 kDa\nObserved Molecular Weight: 25-28 kDa\nGenBank Accession Number: BC035938\nGene Symbol: MOG\nGene ID (NCBI): 4340\nRRID: AB_2881208\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16653\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887721894057,"sku":"28752-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28752-1-ap","provider":"Iright","version":"1.0","type":"link"}