{"product_id":"proteintech-28820-1-ap","title":"Proteintech, 28820-1-AP, WIPI2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WIPI2 (28820-1-AP) by Proteintech is a Polyclonal antibody targeting WIPI2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n28820-1-AP targets WIPI2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, RAW 264.7 cells\nPositive IHC detected in: human heart tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWIPI2, the mammalian homologue of the yeast ATG18 gene, plays a key role in autophagy. It binds the omegasome, a phosphatidylinositol 3-phosphate (PI3P) rich domain of the endoplasmic reticulum from which the mature autophagosome develops. Western blotting detected a 49 kDa WIPI2 band.(PMID: 30968111, PMID: 30403914)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30505 Product name: Recombinant human WIPI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 368-454 aa of BC004116 Sequence: ALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD Predict reactive species\nFull Name: WD repeat domain, phosphoinositide interacting 2\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC004116\nGene Symbol: WIPI2\nGene ID (NCBI): 26100\nRRID: AB_2881218\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y4P8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868991443113,"sku":"28820-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28820-1-ap","provider":"Iright","version":"1.0","type":"link"}