{"product_id":"proteintech-28837-1-ap","title":"Proteintech, 28837-1-AP, NSF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NSF (28837-1-AP) by Proteintech is a Polyclonal antibody targeting NSF in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n28837-1-AP targets NSF in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse cerebellum tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe N-ethylmaleimide-sensitive fusion protein (NSF) is a 70-83 kDa cytosol protein that is expressed in all cell types. NSF functions as an ATPase and it is a part of the 20S membrane fusion apparatus with the vesicular SNAP receptor (v-SNARE) synaptobrevin, and the target SNAREs (t-SNARE) syntaxin and SNAP-25. With the hydrolysis of ATP by NSF, the released energy may set-up or drive membrane fusion processes. NSF is required for general membrane transport and trafficking.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30229 Product name: Recombinant human NSF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 95-255 aa of BC030613 Sequence: MTIEIDFLQKKSIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNEKLFGLLVKDIEAMDPSILKGEPATGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKG Predict reactive species\nFull Name: N-ethylmaleimide-sensitive factor\nCalculated Molecular Weight: 744 aa, 83 kDa\nObserved Molecular Weight: 70-83 kDa\nGenBank Accession Number: BC030613\nGene Symbol: NSF\nGene ID (NCBI): 4905\nRRID: AB_2918208\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P46459\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887742963881,"sku":"28837-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28837-1-ap","provider":"Iright","version":"1.0","type":"link"}