{"product_id":"proteintech-28841-1-ap","title":"Proteintech, 28841-1-AP, MYO1F Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYO1F (28841-1-AP) by Proteintech is a Polyclonal antibody targeting MYO1F in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n28841-1-AP targets MYO1F in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, rat spleen tissue\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMyosin family members are proteins that hydrolyze ATP to generate force or directional movement along actin filaments and are implicated in the rearrangement of the cytoskeleton in several cell types. Myosin 1F (MYO1F), a long tailed class I myosin, is highly expressed in natural killer (NK) cells, macrophages, dendritic cells, and neutrophils. MYO1F plays a critical role in the mediating of signaling molecules \"trafficking from membrane to cytoplasm,\" and this process is essential for the antifungal signaling pathway activation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29899 Product name: Recombinant human MYO1F protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 198-276 aa of BC028071 Sequence: VMQNENERNFHIYYQLLEGASQEQRQNLGLMTPDYYYYLNQSDTYQVDGTDDRSDFGETLSAMQVIGIPPSIQQLVLQL Predict reactive species\nFull Name: myosin IF\nCalculated Molecular Weight: 1098 aa, 125 kDa\nObserved Molecular Weight: 115-125 kDa\nGenBank Accession Number: BC028071\nGene Symbol: MYO1F\nGene ID (NCBI): 4542\nRRID: AB_3669671\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00160\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887730872489,"sku":"28841-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28841-1-ap","provider":"Iright","version":"1.0","type":"link"}