{"product_id":"proteintech-28883-1-ap","title":"Proteintech, 28883-1-AP, CORO2A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CORO2A (28883-1-AP) by Proteintech is a Polyclonal antibody targeting CORO2A in WB, IHC, ELISA applications with reactivity to Human, mouse samples\n28883-1-AP targets CORO2A in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, Raji cells\nPositive IHC detected in: human skin cancer tissue, mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCORO2A (Coronin 2A), also named as CLIPINB, is a member of the 'short' coronin subfamily containing a single WD40-repeat domain. It has been shown that the expression of CORO2A is up-regulated in human colon cancer. CORO2A can interact with MAPK14 and PRMT5. The calculated MW of CORO2A is 60 kDa, while 28883-1-AP antibody detects 48 kDa protein which is similar to the paper published. (PMID: 26373535)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29696 Product name: Recombinant human CORO2A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 162-279 aa of BC000010 Sequence: LDTKESVITSPMSTISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPRAGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEEDLDGSSGVLFPFYD Predict reactive species\nFull Name: coronin, actin binding protein, 2A\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC000010\nGene Symbol: CORO2A\nGene ID (NCBI): 7464\nRRID: AB_2881227\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92828\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886825853097,"sku":"28883-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28883-1-ap","provider":"Iright","version":"1.0","type":"link"}