{"product_id":"proteintech-28887-1-ap","title":"Proteintech, 28887-1-AP, OPRM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OPRM1 (28887-1-AP) by Proteintech is a Polyclonal antibody targeting OPRM1 in WB, ELISA applications with reactivity to human samples\n28887-1-AP targets OPRM1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SK-N-SH cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOPRM1 (also known as Mu opioid receptor, MOR1, MOP) is a G protein-coupled receptor that mediates the physiological effects of endogenous opioids as well as the structurally distinct opioid alkaloids including morphine and etorphine (PMID: 9618555). Mu opioid receptor modulates a wide range of physiological functions, particularly involved in the control of pain perception and reward properties (PMID: 30483121). Mu opioid receptor is the principal target of opioid drugs. It is encoded by OPRM1 gene and multiple transcript variants encoding different isoforms have been found. Mu opioid receptor contains sites for N-linked glycosylation. The transcript variants and variations of glycosylation may result in migrating bands of Mu opioid receptor (PMID: 21886594; 11359768).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30275 Product name: Recombinant human OPRM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC074927 Sequence: MDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCPPTGSPSMI Predict reactive species\nFull Name: opioid receptor, mu 1\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC074927\nGene Symbol: OPRM1\nGene ID (NCBI): 4988\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35372\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887746306217,"sku":"28887-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28887-1-ap","provider":"Iright","version":"1.0","type":"link"}