{"product_id":"proteintech-28936-1-ap","title":"Proteintech, 28936-1-AP, CD46 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD46 (28936-1-AP) by Proteintech is a Polyclonal antibody targeting CD46 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n28936-1-AP targets CD46 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  A549 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD46, also known as Membrane cofactor protein (MCP) or MIC10, is a ubiquitously expressed type type-I transmembrane glycoprotein that acts as a cofactor for complement factor I to mediate inactivation of C3b and C4b deposited on host cells. CD46 is a receptor for a large number of pathogens, including measles virus and adenovirus (PMID: 20941397). CD46 plays a role in linking innate and adaptive immune responses. It may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations of the CD46 gene have been associated with some diseases including hemolytic uremic syndrome (PMID: 26054645). CD46 is expressed on most cells as four isoforms that are derived via alternative splicing (PMID: 15324743).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30376 Product name: Recombinant human CD46 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 38-179 aa of BC030594 Sequence: PPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILYCELKGSVAIWSGKPPICEKVLCTPPPKIKNGKHTFSEVE Predict reactive species\nFull Name: CD46 molecule, complement regulatory protein\nCalculated Molecular Weight: 384 aa, 43 kDa\nObserved Molecular Weight: 50-70 kDa\nGenBank Accession Number: BC030594\nGene Symbol: CD46\nGene ID (NCBI): 4179\nRRID: AB_2881233\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15529\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886259327145,"sku":"28936-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-28936-1-ap","provider":"Iright","version":"1.0","type":"link"}