{"product_id":"proteintech-29022-1-ap","title":"Proteintech, 29022-1-AP, APAF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe APAF1 (29022-1-AP) by Proteintech is a Polyclonal antibody targeting APAF1 in WB, ELISA applications with reactivity to Human samples\n29022-1-AP targets APAF1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAPAF1, also named as Apoptotic protease-activating factor 1 or KIAA0413, is a 1248 amino acid protein, which contains one CARD domain, contains one NB-ARC domain and Contains fifteen WD repeats. APAF1 localizes in the cytoplasm and is widely expressed in many tissues. Highest levels of expression is in adult spleen, peripheral blood leukocytes, in fetal brain, kidney and lung. Oligomeric APAF1 mediates the cytochrome c-dependent autocatalytic activation of pro-caspase-9 (Apaf-3), leading to the activation of caspase-3 and apoptosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30606 Product name: Recombinant human APAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 978-1110 aa of BC136532 Sequence: FGDENGAIEILELVNNRIFQSRFQHKKTVWHIQFTADEKTLISSSDDAEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGNKEKDFVCHQGTVLSCDISHDATKFSSTSADKTAK Predict reactive species\nFull Name: apoptotic peptidase activating factor 1\nCalculated Molecular Weight: 1248 aa, 142 kDa\nObserved Molecular Weight: 130-140 kDa\nGenBank Accession Number: BC136532\nGene Symbol: APAF1\nGene ID (NCBI): 317\nRRID: AB_2923588\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14727\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869443969193,"sku":"29022-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29022-1-ap","provider":"Iright","version":"1.0","type":"link"}