{"product_id":"proteintech-29080-1-ap","title":"Proteintech, 29080-1-AP, RIPK3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RIPK3 (29080-1-AP) by Proteintech is a Polyclonal antibody targeting RIPK3 in WB, ELISA applications with reactivity to human samples\n29080-1-AP targets RIPK3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRIPK3,also named as RIP3, a Ser\/Thr kinase of RIP (Receptor Interacting Protein) family, is recruited to the TNFR1 signaling complex through RIP and has been shown to mediate apoptosis induction and NF-κB activation. RIPK3 is a nucleocytoplasmic shuttling protein and its unconventional nuclear localization signal (NLS, 442-472 aa) is sufficient to trigger apoptosis in the nucleus(PMID:18533105). It has 3 isoforms produced by alternative splicing. RIPK3 might form a homodimer within cells, and its apoptotic activity may not be required for this dimerization(PMID:18533105).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30337 Product name: Recombinant human RIPK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-202 aa of BC062584 Sequence: HDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTAS Predict reactive species\nFull Name: receptor-interacting serine-threonine kinase 3\nCalculated Molecular Weight: 518 aa, 57 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC062584\nGene Symbol: RIPK3\nGene ID (NCBI): 11035\nRRID: AB_3086097\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y572\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868817510569,"sku":"29080-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29080-1-ap","provider":"Iright","version":"1.0","type":"link"}