{"product_id":"proteintech-29115-1-ap","title":"Proteintech, 29115-1-AP, PTH1R Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTH1R (29115-1-AP) by Proteintech is a Polyclonal antibody targeting PTH1R in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n29115-1-AP targets PTH1R in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse kidney tissue,  HepG2 cells,  mouse liver tissue,  rat kidney tissue,  rat liver tissue\nPositive IHC detected in: human pancreas cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTH1R is a receptor for parathyroid hormone and parathyroid hormone-related peptide (PTHrP). PTH1R is a glycoprotein with seven transmembrane domains and it has an extracellular N-terminus region and an intracellular C-terminus region. The activity of PTH1R is mediated by G proteins which activate adenylyl cyclase. It has been reported that PTHrP and PTH1R are associated with the differentiation of bone and cartilage in the developing stages. PTH1R has several isoforms with 66\/59 kDa and PTH1R can form a 120 kDa dimer in the non-reducing condition. With glycosylation modification, the molecular weight of PTH1R will be migrated to 90 kDa (PMID: 16783882).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30762 Product name: Recombinant human PTH1R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-188 aa of BC110388 Sequence: DADDVMTKEEQIFLLHRAQAQCGKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG Predict reactive species\nFull Name: parathyroid hormone 1 receptor\nCalculated Molecular Weight: 593 aa, 66 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: BC110388\nGene Symbol: PTH1R\nGene ID (NCBI): 5745\nRRID: AB_2918237\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q03431\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887776780457,"sku":"29115-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29115-1-ap","provider":"Iright","version":"1.0","type":"link"}