{"product_id":"proteintech-29185-1-ap","title":"Proteintech, 29185-1-AP, SULT2B1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SULT2B1 (29185-1-AP) by Proteintech is a Polyclonal antibody targeting SULT2B1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n29185-1-AP targets SULT2B1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse skin tissue,  LNCaP cells,  MCF-7 cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSULT2B1 is a member of hydroxysteroid sulfotransferase (SULT) family that catalyzes sulfonation of hormones and other molecules. SULT2B1 encodes two isoforms, SULT2B1a and SULT2B1b, that differ only at their amino termini but have distinct biochemical properties as well as tissue distribution. The human fetal brain appears to only express the SULT2B1a isoform, while SULT2B1b is the predominant hydroxysteroid sulfotransferase expressed in human skin. Northern blot analysis revealed SULT2B1a has a limited tissue distribution in liver, adrenal and stomach, whereas SULT2B1b can be detected in a variety of hormone-responsive tissues including placenta, ovary, uterus, and prostate.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30209 Product name: Recombinant human SULT2B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 283-365 aa of BC034694 Sequence: NHFTVAQSEAFDRAYRKQMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPSPSPGQASETPHPRPS Predict reactive species\nFull Name: sulfotransferase family, cytosolic, 2B, member 1\nCalculated Molecular Weight: 365 aa, 41 kDa\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: BC034694\nGene Symbol: SULT2B1\nGene ID (NCBI): 6820\nRRID: AB_2918245\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00204\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887819411625,"sku":"29185-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29185-1-ap","provider":"Iright","version":"1.0","type":"link"}