{"product_id":"proteintech-29219-1-ap","title":"Proteintech, 29219-1-AP, CBLL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CBLL1 (29219-1-AP) by Proteintech is a Polyclonal antibody targeting CBLL1 in WB, IHC, ELISA applications with reactivity to human samples\n29219-1-AP targets CBLL1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  NCI-H1299 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCbl proto‐oncogene E3 ubiquitin protein ligase‐like 1, RNF188, Hakai (CBLL1) is an evolutionarily conserved E3 ubiquitin ligase containing a RING‐finger domain. CBLL1 contains a typical RING‐finger, short pTyr‐binding domain, and proline‐rich domain. CBLL1 expression is upregulated in human colon and gastric cancer tissues, and CBLL1 has been reported to induce anchorage‐dependent cell growth. CBLL1 immunostaining was observed in both the nuclei and cytoplasm of cancer cells.  (PMID: 31124298, PMID: 31646569, PMID: 21191016)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30900 Product name: Recombinant human CBLL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-110 aa of BC027460 Sequence: DVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDEEGFDYNEEERYDCKGGELFANQRRFPGHLFWDFQINILGEKDDTPVHFCDKCG Predict reactive species\nFull Name: Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1\nCalculated Molecular Weight: 491 aa, 55 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC027460\nGene Symbol: CBLL1\nGene ID (NCBI): 79872\nRRID: AB_2918251\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q75N03\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885849006249,"sku":"29219-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29219-1-ap","provider":"Iright","version":"1.0","type":"link"}