{"product_id":"proteintech-29230-1-ap","title":"Proteintech, 29230-1-AP, CLCN7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLCN7 (29230-1-AP) by Proteintech is a Polyclonal antibody targeting CLCN7 in WB, ELISA applications with reactivity to human samples\n29230-1-AP targets CLCN7 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse kidney tissue,  mouse small intestine mouse small intestine,  rat small intestine rat small intestine\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe intracellular CLC chloride channel family members ClC-3, ClC-4, and ClC-5 have been proposed as the primary endosomal chloride conductance providers. ClC-7 is expressed in late endosomes and lysosomes, but there is disagreement in the literature regarding its contribution to acidification. More recently, the cystic fibrosis (CF) transmembrane conductance regulator chloride channel (CFTR) was proposed as the specific counter-ion conductance necessary for lysosomal acidification in alveolar macrophages. (PMID: 20566682)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29882 Product name: Recombinant human CLCN7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-126 aa of BC012737 Sequence: MANVSKKVSWSGRDRDDEEAAPLLRRTARPGGGTPLLNGAGPGAARQSPRSALFRVGHMSSVELDDELLDPDMDPPHPFPKEIPHNEKLLSLKYESLDYDNSENQLFLEEERRINHTAFRTVEIKR Predict reactive species\nFull Name: chloride channel 7\nCalculated Molecular Weight: 805 aa, 89 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC012737\nGene Symbol: CLCN7\nGene ID (NCBI): 1186\nRRID: AB_3669678\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51798\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886592577705,"sku":"29230-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29230-1-ap","provider":"Iright","version":"1.0","type":"link"}