{"product_id":"proteintech-29253-1-ap","title":"Proteintech, 29253-1-AP, KLHL14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KLHL14 (29253-1-AP) by Proteintech is a Polyclonal antibody targeting KLHL14 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n29253-1-AP targets KLHL14 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKelch-like protein 14 (KLHL14) is a member of the KLHL family. The kelch motif was initially discovered in Kelch. In this protein there are six copies of the motif. It has been shown for one member that it is related to Galactose Oxidase for which a structure has been solved. Two isoforms of this protein exist - 70kDa and 43kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29188 Product name: Recombinant human KLHL14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC021267 Sequence: MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAVLASCSQYFRSLFSSHPPLGGGVGGQDGLGAPKDQQQPPQQQPSQQQQPPPQEEPGTPSSSPDDKLLTSPRAINNLVLQGCSSIGLRLVLEYLYTANVTLSLDTVEEVLSVSKILHIPQVTKLCVQFLNDQISVQNYKQVCKIAALHGLEETKKLANKYLVEDVLLLNF Predict reactive species\nFull Name: kelch-like 14 (Drosophila)\nCalculated Molecular Weight: 44 kDa, 71 kDa\nObserved Molecular Weight: 43 kDa, 70 kDa\nGenBank Accession Number: BC021267\nGene Symbol: KLHL14\nGene ID (NCBI): 57565\nRRID: AB_3669680\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P2G3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887698006185,"sku":"29253-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29253-1-ap","provider":"Iright","version":"1.0","type":"link"}