{"product_id":"proteintech-29278-1-ap","title":"Proteintech, 29278-1-AP, KMT2A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KMT2A (29278-1-AP) by Proteintech is a Polyclonal antibody targeting KMT2A in WB, ELISA applications with reactivity to human samples\n29278-1-AP targets KMT2A in WB, IF, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKMT2A, also known as mixed-lineage leukemia (MLL), is a gene that encodes a lysine methyltransferase responsible for the transcriptional activation through lysine 4 of histone 3 (H3K4) methylation. KMT2A is expressed mainly in the nucleus and is ubiquitously present in various tissues, particularly in ovary, lymph node, endometrium, thyroid, and brain tissue. It plays a significant role in embryonic development, hematopoiesis, and neurodevelopment. Mutations in KMT2A have been associated with several pathological conditions.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30468 Product name: Recombinant human MLL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3520-3670 aa of NM_001197104 Sequence: SSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLV Predict reactive species\nFull Name: myeloid\/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)\nCalculated Molecular Weight: 432 kDa\nObserved Molecular Weight: 180 kDa\nGenBank Accession Number: NM_001197104\nGene Symbol: MLL\nGene ID (NCBI): 4297\nRRID: AB_2918266\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q03164\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869469102249,"sku":"29278-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29278-1-ap","provider":"Iright","version":"1.0","type":"link"}