{"product_id":"proteintech-29307-1-ap","title":"Proteintech, 29307-1-AP, PAX2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PAX2 (29307-1-AP) by Proteintech is a Polyclonal antibody targeting PAX2 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n29307-1-AP targets PAX2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse cerebellum tissue, rat cerebellum tissue\nPositive IHC detected in: mouse kidney tissue, human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPAX2 is a transcription factor, primarily expressed during embryonic development. It has a critical role in the development of the urogenital tract, the eyes, and the CNS. It plays a key role during renal development and to act as an oncogene favoring renal tumor growth. PAX2 was suggested as a sensitive and highly specific marker for renal cell carcinoma (RCC).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30717 Product name: Recombinant human PAX2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 189-386 aa of BC148710 Sequence: GILGIPRSNGEKRKRDEVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRF Predict reactive species\nFull Name: paired box 2\nCalculated Molecular Weight: 431 aa, 46 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC148710\nGene Symbol: PAX2\nGene ID (NCBI): 5076\nRRID: AB_2918278\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q02962\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869480243369,"sku":"29307-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29307-1-ap","provider":"Iright","version":"1.0","type":"link"}