{"product_id":"proteintech-29321-1-ap","title":"Proteintech, 29321-1-AP, SPATA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPATA2 (29321-1-AP) by Proteintech is a Polyclonal antibody targeting SPATA2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n29321-1-AP targets SPATA2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe protein SPATA2 (spermatogenesis-associated protein 2) was initially shown to be highly expressed in testicular Sertoli cells, and these early reports suggested SPATA2 to play a role in spermatogenesis. More recently, it was discussed to be involved in the predisposition for psoriasis. SPATA2 is required for TNF-induced cell death. SPATA2 has a potential role during pancreatic development and β-cell proliferation.(PMID: 20119533\/PMID: 27458237)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30773 Product name: Recombinant human SPATA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 330-520 aa of BC009481 Sequence: STQDDVDLYTDSEPRATYRRQDALRPDVWLLRNDAHSLYHKRSPPAKESALSKCQSCGLSCSSSLCQRCDSLLTCPPASKPSAFPSKASTHDSLAHGASLREKYPGQTQGLDRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYDPCYKKSELHKFMPNNQLNYKSTQLSHLVYR Predict reactive species\nFull Name: spermatogenesis associated 2\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 58-60 kDa\nGenBank Accession Number: BC009481\nGene Symbol: SPATA2\nGene ID (NCBI): 9825\nRRID: AB_2918282\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UM82\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887813677225,"sku":"29321-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29321-1-ap","provider":"Iright","version":"1.0","type":"link"}