{"product_id":"proteintech-29329-1-ap","title":"Proteintech, 29329-1-AP, GPX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPX1 (29329-1-AP) by Proteintech is a Polyclonal antibody targeting GPX1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples\n29329-1-AP targets GPX1 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, THP-1 cells,  mouse kidney tissue,  rat kidney tissue,  SMMC-7721 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGpx protein, known as selenoprotein, consists selenium in its catalytic site. Gpx1 is an abundant isoform, which involves in scavenging endogenous ROS using electron provided by reduced glutathione and ubiquitously expressed the cytoplasm and mitochondria of all cell types. (PMID: 30632027)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: human, mouse, rat, pig, chicken, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31101 Product name: Recombinant human GPX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 102-203 aa of BC000742 Sequence: GGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA Predict reactive species\nFull Name: glutathione peroxidase 1\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC000742\nGene Symbol: GPX1\nGene ID (NCBI): 2876\nRRID: AB_2918283\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07203\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868861550761,"sku":"29329-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29329-1-ap","provider":"Iright","version":"1.0","type":"link"}