{"product_id":"proteintech-29330-1-ap","title":"Proteintech, 29330-1-AP, Renin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Renin (29330-1-AP) by Proteintech is a Polyclonal antibody targeting Renin in WB, IF\/ICC, ELISA applications with reactivity to human, monkey samples\n29330-1-AP targets Renin in WB, IF\/ICC, ELISA applications and shows reactivity with human, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COS-7 cells, HepG2 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRenin is an aspartic protease that consists of 2 homologous lobes,   produced as pre-prorenin protein and transferred into the cisterns of the endoplasmic reticulum. Renin is mainly produced and released into circulation by the so-called juxtaglomerular epithelioid cells, located in the walls of renal afferent arterioles at the entrance of the glomerular capillary network (PMID: 16525949).REN has 2 isoforms produced by alternative splicing with a molecular weight of 45-47kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31071 Product name: Recombinant human REN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 112-235 aa of BC047752 Sequence: VPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENS Predict reactive species\nFull Name: renin\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC047752\nGene Symbol: Renin\nGene ID (NCBI): 5972\nRRID: AB_3086119\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00797\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887782580393,"sku":"29330-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29330-1-ap","provider":"Iright","version":"1.0","type":"link"}