{"product_id":"proteintech-29342-1-ap","title":"Proteintech, 29342-1-AP, HDAC5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HDAC5 (29342-1-AP) by Proteintech is a Polyclonal antibody targeting HDAC5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse samples\n29342-1-AP targets HDAC5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  MCF-7 cells,  PC-3 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHistone acetylation and deacetylation alternately exposes and occludes DNA to transcription factors. At least 4 classes of HDAC were identified. HDAC5 is a class II HDAC. HDAC5 responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. HDAC5 is involved in muscle maturation by repressing transcription of myocyte enhancer MEF2C. During muscle differentiation, HDAC5 shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29122 Product name: Recombinant human HDAC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 557-682 aa of NM_005474 Sequence: TEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGGMKSPPDQPVKHLFT Predict reactive species\nFull Name: histone deacetylase 5\nCalculated Molecular Weight: 122 kDa\nObserved Molecular Weight: 120-140 kDa\nGenBank Accession Number: NM_005474\nGene Symbol: HDAC5\nGene ID (NCBI): 10014\nRRID: AB_3086120\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UQL6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869691793577,"sku":"29342-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29342-1-ap","provider":"Iright","version":"1.0","type":"link"}