{"product_id":"proteintech-29402-1-ap","title":"Proteintech, 29402-1-AP, IER3IP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IER3IP1 (29402-1-AP) by Proteintech is a Polyclonal antibody targeting IER3IP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human samples\n29402-1-AP targets IER3IP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28027 Product name: Recombinant human IER3IP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC010888 Sequence: MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIVNSIAIVLLLLFG Predict reactive species\nFull Name: immediate early response 3 interacting protein 1\nCalculated Molecular Weight: 82 aa, 9 kDa\nObserved Molecular Weight: 9 kDa\nGenBank Accession Number: BC010888\nGene Symbol: IER3IP1\nGene ID (NCBI): 51124\nRRID: AB_2918295\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5U9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887675855017,"sku":"29402-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29402-1-ap","provider":"Iright","version":"1.0","type":"link"}