{"product_id":"proteintech-29417-1-ap","title":"Proteintech, 29417-1-AP, SEC16A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEC16A (29417-1-AP) by Proteintech is a Polyclonal antibody targeting SEC16A in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n29417-1-AP targets SEC16A in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  HeLa cells\nPositive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSEC16A, also named as KIAA0310, SEC16 and SEC16L, is required for secretory cargo trafic from the endoplasmic reticulum to the Golgi apparatus. SAR1A-GTP-dependent assembly of SEC16A on the ER membrane forms an organized scaffold defining an ERES. SEC16A is required for normal transitional endoplasmic reticulum (tER) organization.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30700 Product name: Recombinant human SEC16A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 550-722 aa of NM_014866 Sequence: EVGKPEDEASGSFFKQIDSSPVGGETDETTVSQNYRGSVSQPSTPSPPKPTGIFQTSANSSFEPVKSHLVGVKPFEADRANVVGEVRETCVRQKQCRPAAALPDASPGNLEQPPDNMETLCAPQVCPLPLNSTTEAVHMLPHAGAPPLDTVYPAPEKRPSARTQGPVKCESPA Predict reactive species\nFull Name: SEC16 homolog A (S. cerevisiae)\nCalculated Molecular Weight: 252 kDa\nObserved Molecular Weight: 250-300 kDa\nGenBank Accession Number: NM_014866\nGene Symbol: SEC16A\nGene ID (NCBI): 9919\nRRID: AB_3086130\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15027\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887795392681,"sku":"29417-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29417-1-ap","provider":"Iright","version":"1.0","type":"link"}