{"product_id":"proteintech-29488-1-ap","title":"Proteintech, 29488-1-AP, INO80B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe INO80B (29488-1-AP) by Proteintech is a Polyclonal antibody targeting INO80B in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse samples\n29488-1-AP targets INO80B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HeLa cells,  MCF-7 cells\nPositive IHC detected in: mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nINO80B (INO80 complex subunit B), also known as ZNHIT4 (zinc finger HIT domain-containing protein 4), PAPA1 (PAP-1-associated protein 1), is a subunit of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. INO80B is localized to the nucleolus. The function of INO80B is to induce growth arrest by haulting the cell cycle at the G1 phase. INO80B expression is controlled at the transcriptional level and is highest at the G0 and G1 phases of the cell cycle. In vitro, INO80B binds PAP-1, a splicing factor, and may play a role in nucleolar complexes that regulate ribosome biogenesis and cell cycle events.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30345 Product name: Recombinant human INO80B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-265 aa of BC050666 Sequence: HGHGVHKKKHKKHKKKHKKKHHQEEDAGPTQPSPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRAWLDEDSNLSPSPLRDLSGGLGGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREERARKRRLQAARRAEEHKNQTIERLTKTAATSGRGGRGGARGERRGGRA Predict reactive species\nFull Name: INO80 complex subunit B\nCalculated Molecular Weight: 356 aa, 39 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC050666\nGene Symbol: INO80B\nGene ID (NCBI): 83444\nRRID: AB_2918316\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9C086\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887684210857,"sku":"29488-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29488-1-ap","provider":"Iright","version":"1.0","type":"link"}