{"product_id":"proteintech-29496-1-ap","title":"Proteintech, 29496-1-AP, COQ10A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COQ10A (29496-1-AP) by Proteintech is a Polyclonal antibody targeting COQ10A in WB, ELISA applications with reactivity to human, mouse, rat samples\n29496-1-AP targets COQ10A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse skeletal muscle tissue,  rat heart tissue,  rat skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOQ10A is a human gene that encodes a protein involved in the biosynthesis of coenzyme Q10 (CoQ10), also known as ubiquinone. CoQ10 is a lipid-soluble antioxidant and a critical component of the mitochondrial electron transport chain, where it plays a key role in cellular energy production (ATP synthesis). Mutations or deficiencies in COQ10A have been implicated in primary CoQ10 deficiency syndromes, which can manifest as mitochondrial disorders such as encephalomyopathy, nephropathy, and Leigh syndrome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31534 Product name: Recombinant human COQ10A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-247 aa of NM_144576 Sequence: MAWAGSRRVPAGTRAAAERCCRLSLSPGAQPAPPPGPLPPPRPMRFLTSCSLLLPRAAQILAAEAGLPSSRSFMGFAAPFTNKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGPETAIPRELMFHEVHQT Predict reactive species\nFull Name: coenzyme Q10 homolog A (S. cerevisiae)\nCalculated Molecular Weight: 28KD\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: NM_144576\nGene Symbol: COQ10A\nGene ID (NCBI): 93058\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96MF6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886813761705,"sku":"29496-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29496-1-ap","provider":"Iright","version":"1.0","type":"link"}