{"product_id":"proteintech-29520-1-ap","title":"Proteintech, 29520-1-AP, TM9SF4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TM9SF4 (29520-1-AP) by Proteintech is a Polyclonal antibody targeting TM9SF4 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n29520-1-AP targets TM9SF4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, PC-3 cells,  mouse kidney tissue\nPositive IHC detected in: human stomach cancer tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31253 Product name: Recombinant human TM9SF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-210 aa of BC021107 Sequence: EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFEVIPQSIRLEDLKADEKSSC Predict reactive species\nFull Name: transmembrane 9 superfamily protein member 4\nCalculated Molecular Weight: 642 aa, 75 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC021107\nGene Symbol: TM9SF4\nGene ID (NCBI): 9777\nRRID: AB_3086139\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92544\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868817641641,"sku":"29520-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29520-1-ap","provider":"Iright","version":"1.0","type":"link"}