{"product_id":"proteintech-29587-1-ap","title":"Proteintech, 29587-1-AP, NCOA3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NCOA3 (29587-1-AP) by Proteintech is a Polyclonal antibody targeting NCOA3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n29587-1-AP targets NCOA3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, HEK-293 cells,  Hela cells,  Jurkat cells,  K-562 cells,  MCF-7 cells,  PC-3 cells\nPositive IHC detected in: human lung cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNCOA3, also named as AIB1, SRC3 and TRAM1, belongs to the SRC\/p160 nuclear receptor coactivator family. NCOA3 is a nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. NOCA3 plays a central role in creating a multisubunit coactivator complex, which probably acts via remodeling of chromatin. Involved in the coactivation of different nuclear receptors, such as for steroids (GR and ER), retinoids (RARs and RXRs), thyroid hormone (TRs), vitamin D3 (VDR) and prostanoids (PPARs). NCOA3 also involved in the coactivation of the NF-kappa-B pathway via its interaction with the NFKB1 subunit.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30633 Product name: Recombinant human NCOA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 742-958 aa of BC119001 Sequence: LDRDDPSDALSKELQPQVEGVDNKMSQCTSSTIPSSSQEKDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSLGLKSSQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGSSMGGPNRNVTVTQTPSSGDWGLPNSKAGRMEPMNSNSMGRPGGDYNTSLPRPALGGSI Predict reactive species\nFull Name: nuclear receptor coactivator 3\nCalculated Molecular Weight: 1424 aa, 155 kDa\nObserved Molecular Weight: 150-160 kDa\nGenBank Accession Number: BC119001\nGene Symbol: NCOA3\nGene ID (NCBI): 8202\nRRID: AB_2918328\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6Q9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887733657769,"sku":"29587-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29587-1-ap","provider":"Iright","version":"1.0","type":"link"}