{"product_id":"proteintech-29601-1-ap","title":"Proteintech, 29601-1-AP, RELB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RELB (29601-1-AP) by Proteintech is a Polyclonal antibody targeting RELB in WB, IHC, IP, ELISA applications with reactivity to human samples\n29601-1-AP targets RELB in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, Ramos cells\nPositive IP detected in: Raji cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRELB is one of the more unusual members of the NF-κB family, it is best known for its roles in lymphoid development, DC biology, and noncanonical signaling. RELB is capable of direct binding to the AhR that supports the xenobiotic-detoxifying pathway. RELB can regulate the circadian rhythm by directly binding to the BMAL partner of CLOCK.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30334 Product name: Recombinant human RELB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 375-446 aa of BC028013 Sequence: VTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKKKPAILDHFL Predict reactive species\nFull Name: v-rel reticuloendotheliosis viral oncogene homolog B\nCalculated Molecular Weight: 62 kDa\nObserved Molecular Weight: 62-65 kDa\nGenBank Accession Number: BC028013\nGene Symbol: RELB\nGene ID (NCBI): 5971\nRRID: AB_2918330\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01201\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887782285481,"sku":"29601-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29601-1-ap","provider":"Iright","version":"1.0","type":"link"}