{"product_id":"proteintech-29653-1-ap","title":"Proteintech, 29653-1-AP, PPT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPT1 (29653-1-AP) by Proteintech is a Polyclonal antibody targeting PPT1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n29653-1-AP targets PPT1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, A549 cells,  HeLa cells,  SH-SY5Y cells,  mouse testis tissue,  rat testis tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe defective gene behind the INCL(infantile neuronal ceroid lipofuscinoses) disease, CLN1, encodes for palmitoyl protein thioesterase 1 (PPT1). It consists of 306 amino acids, including a signal sequence of 26 amino acids and three N-linked glycosylation sites. This protein exists with a molecular mass of 32 kDa, 34 kDa,36 kDa, and 38 kDa. The enzyme is transported into lysosomes of non-neuronal cells by the mannose 6-phosphate receptor (M6PR) mediated pathway and a significant amount of native PPT1 resides in a complex rather than in a monomeric form(PMID:17565660).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31240 Product name: Recombinant human PPT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 150-306 aa of BC008426 Sequence: PRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG Predict reactive species\nFull Name: palmitoyl-protein thioesterase 1\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 32-34 kDa\nGenBank Accession Number: BC008426\nGene Symbol: PPT1\nGene ID (NCBI): 5538\nRRID: AB_2923599\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P50897\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869577040041,"sku":"29653-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29653-1-ap","provider":"Iright","version":"1.0","type":"link"}