{"product_id":"proteintech-29662-1-ap","title":"Proteintech, 29662-1-AP, SYNPO Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SYNPO (29662-1-AP) by Proteintech is a Polyclonal antibody targeting SYNPO in WB, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n29662-1-AP targets SYNPO in WB, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSynaptopodin is a actin-associated protein expressed in mature dendritic spines and renal podocytes. Several isoforms of synaptopodin have been reported: the 100 kDa neural form and 110 kDa renal form. 44-45 kDa may represent the degradation product of synaptopodin. As a podocyte specific protein, synaptopodin expression level was decreased in kidney but increased in the urinary podocytes from patients with preeclampsia, indicating that synaptopodin is a useful marker for preeclampsia. (15841212, 10555072)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31287 Product name: Recombinant human SYNPO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 336-510 aa of BC146665 Sequence: SPPSYSVLYPSSDPKSSHLKGQAVPASKTGILEESMARRGSRKSMFTFVEKPKVTPNPDLLDLVQTADEKRRQRDQGEVGVEEEPFALGAEASNFQQEPAPRDRASPAAAEEVVPEWASCLKSPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEKYVIESSSHTPELARCPS Predict reactive species\nFull Name: synaptopodin\nCalculated Molecular Weight: 929 aa, 99 kDa\nObserved Molecular Weight: 44 kDa, 74-100 kDa\nGenBank Accession Number: BC146665\nGene Symbol: SYNPO\nGene ID (NCBI): 11346\nRRID: AB_3086150\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N3V7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869774598313,"sku":"29662-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29662-1-ap","provider":"Iright","version":"1.0","type":"link"}