{"product_id":"proteintech-29709-1-ap","title":"Proteintech, 29709-1-AP, KLF10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KLF10 (29709-1-AP) by Proteintech is a Polyclonal antibody targeting KLF10 in WB, IHC, ELISA applications with reactivity to Human, mouse samples\n29709-1-AP targets KLF10 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  MCF-7 cells\nPositive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKLF10 (Krueppel-like factor 10), also known as TIEG1, is a transcription factor that plays a role in the regulation of cell growth. KLF10 plays a role in the response to TGF beta (through the TGF beta\/Smad signaling pathway) and estrogen. KLF10 has been shown to have a role in skeletal disease (osteopenia\/osteoporosis), hypertrophic cardiomyopathy, and breast and prostate cancer. KLF10 can be detected 51-52 kDa, 60-75 kDa (PMID: 21262377, PMID: 30026232).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31772 Product name: Recombinant human KLF10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC011538 Sequence: MEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKA Predict reactive species\nFull Name: Kruppel-like factor 10\nCalculated Molecular Weight: 469 aa, 51 kDa\nObserved Molecular Weight: 52-75 kDa\nGenBank Accession Number: BC011538\nGene Symbol: KLF10\nGene ID (NCBI): 7071\nRRID: AB_2918341\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13118\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869468905641,"sku":"29709-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29709-1-ap","provider":"Iright","version":"1.0","type":"link"}