{"product_id":"proteintech-29756-1-ap","title":"Proteintech, 29756-1-AP, FMNL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FMNL3 (29756-1-AP) by Proteintech is a Polyclonal antibody targeting FMNL3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n29756-1-AP targets FMNL3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\nPositive IHC detected in: human colon cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFMNL3 plays a role in the regulation of cell morphology and cytoskeletal organization. It is required in the control of cell shape and migration. In quiescent endothelial cells, FMNL3 triggers rearrangement of the actin cytoskeleton, but does not alter microtubule alignement.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30543 Product name: Recombinant human FMNL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 403-510 aa of NM_175736 Sequence: EHVSHLTEKLLDLENENMMRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLESVDSEALARVGPAELSEGMPPSDLDLLAPAP Predict reactive species\nFull Name: formin-like 3\nCalculated Molecular Weight: 117 kDa\nObserved Molecular Weight: 117 kDa\nGenBank Accession Number: NM_175736\nGene Symbol: FMNL3\nGene ID (NCBI): 91010\nRRID: AB_3086155\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IVF7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869684453545,"sku":"29756-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29756-1-ap","provider":"Iright","version":"1.0","type":"link"}