{"product_id":"proteintech-29761-1-ap","title":"Proteintech, 29761-1-AP, NHE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NHE1 (29761-1-AP) by Proteintech is a Polyclonal antibody targeting NHE1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n29761-1-AP targets NHE1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse heart tissue,  rat brain tissue,  rat heart tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNHE1, also named as SLC9A1, encodes an Na+\/H+ antiporter that is a membrane-bound enzyme involved in regulating pH of vertebrate cells. NHE1 regulates a number of cell behaviors, including adhesion, shape determination, migration, and proliferation (PMID:11807182). It is inhibited by the non-specific diuretic drug amiloride and activated by growth factors, mitogens, neurotransmitters, tumor promoters, and others (PMID: 2846238). NHE1 is expressed in heart where it contributes to cardiomyocyte pH homeostasis (PMID: 12832126, PMID: 23709596).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31192 Product name: Recombinant human NHE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 656-815 aa of NM_003047 Sequence: ADPYEEAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITIDPASPQSPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKGQ Predict reactive species\nFull Name: solute carrier family 9 (sodium\/hydrogen exchanger), member 1\nCalculated Molecular Weight: 91 kDa\nObserved Molecular Weight: 90-100 kDa\nGenBank Accession Number: NM_003047\nGene Symbol: NHE1\nGene ID (NCBI): 6548\nRRID: AB_2923605\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P19634\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887736639657,"sku":"29761-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29761-1-ap","provider":"Iright","version":"1.0","type":"link"}