{"product_id":"proteintech-29765-1-ap","title":"Proteintech, 29765-1-AP, POLD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe POLD2 (29765-1-AP) by Proteintech is a Polyclonal antibody targeting POLD2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n29765-1-AP targets POLD2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, NIH\/3T3 cells,  HeLa cells,  Jurkat cells,  SGC-7901 cells,  U-251 cells,  mouse colon tissue,  mouse pancreas tissue,  rat colon tissue\nPositive IHC detected in: human colon tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPOLD2, also named as DNA polymerase delta subunit 2, is a 469 amino acid protein, which belongs to the DNA polymerase delta\/II small subunit family. The function of the small subunit is not yet clear. POLD2 has an essential function for the small subunit in the heterodimeric core enzyme.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31521 Product name: Recombinant human POLD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 40-195 aa of BC000459 Sequence: RLGERSFSRQYAHIYATRLIQMRPFLENRAQQHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRF Predict reactive species\nFull Name: polymerase (DNA directed), delta 2, regulatory subunit 50kDa\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 48-51 kDa\nGenBank Accession Number: BC000459\nGene Symbol: POLD2\nGene ID (NCBI): 5425\nRRID: AB_2918344\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49005\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887767736489,"sku":"29765-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29765-1-ap","provider":"Iright","version":"1.0","type":"link"}