{"product_id":"proteintech-29770-1-ap","title":"Proteintech, 29770-1-AP, ATF7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATF7 (29770-1-AP) by Proteintech is a Polyclonal antibody targeting ATF7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n29770-1-AP targets ATF7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human lung tissue, mouse lung tissue,  human urothelial carcinoma tissue,  mouse heart tissue,  rat heart tissue,  rat lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30882 Product name: Recombinant human ATF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 78-167 aa of NM_001366555 Sequence: FKKAADEDEKKARSRTVAKKLVAAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPDSPASSPCSPPLKEKEVTPKPVLISTPTPTIVRPGSL Predict reactive species\nFull Name: activating transcription factor 7\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 52-60 kDa\nGenBank Accession Number: NM_001366555\nGene Symbol: ATF7\nGene ID (NCBI): 11016\nRRID: AB_3086157\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17544\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869640052905,"sku":"29770-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29770-1-ap","provider":"Iright","version":"1.0","type":"link"}