{"product_id":"proteintech-29772-1-ap","title":"Proteintech, 29772-1-AP, SENP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SENP2 (29772-1-AP) by Proteintech is a Polyclonal antibody targeting SENP2 in WB, IHC, ELISA applications with reactivity to Human samples\n29772-1-AP targets SENP2 in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: EC109 cells, MKN-45 cells,  SGC-7901 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSENP2 (Sentrin-specific protease 2), as a protease, catalyzes two essential functions in the SUMO pathway. The first is the hydrolysis of an alpha-linked peptide bond at the C-terminal end of the small ubiquitin-like modifier (SUMO) propeptides, SUMO1, SUMO2 and SUMO3 leading to the mature form of the proteins (PMID:15296745). The second is the deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins, by cleaving an epsilon-linked peptide bond between the C-terminal glycine of the mature SUMO and the lysine epsilon-amino group of the target protein (PMID:20194620, PMID:21965678). It has 2 isoforms with the molecular weight of 66 and 68 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30728 Product name: Recombinant human SENP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 78-228 aa of NM_021627 Sequence: TKPMVTSACNGTRNVAPSGEVFSNSSSCELTGSGSWNNMLKLGNKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKPQEQAVTEMISEESGKGLRRPHCTVEEGVQKEEREKYRKLLERLKESGH Predict reactive species\nFull Name: SUMO1\/sentrin\/SMT3 specific peptidase 2\nCalculated Molecular Weight: 68 kDa\nObserved Molecular Weight: 60-68 kDa\nGenBank Accession Number: NM_021627\nGene Symbol: SENP2\nGene ID (NCBI): 59343\nRRID: AB_3086158\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HC62\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869595324585,"sku":"29772-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29772-1-ap","provider":"Iright","version":"1.0","type":"link"}