{"product_id":"proteintech-29778-1-ap","title":"Proteintech, 29778-1-AP, RPGRIP1L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RPGRIP1L (29778-1-AP) by Proteintech is a Polyclonal antibody targeting RPGRIP1L in WB, ELISA applications with reactivity to Human, mouse, rat samples\n29778-1-AP targets RPGRIP1L in WB, IF, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse testis tissue,  HEK-293 cells,  Jurkat cells,  rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRPGRIP1L, also named as FTM, KIAA1005, belongs to the RPGRIP1 family. It negatively regulates signaling through the G-protein coupled thromboxane A2 receptor. RPGRIP1L may be involved in mechanisms like programmed cell death, craniofacial development, patterning of the limbs, and formation of the left-right axis.(PMID:17558409) Defects in RPGRIP1L are the cause of Joubert syndrome type 7 (JBTS7). Defects in RPGRIP1L are the cause of Meckel syndrome type 5 (MKS5).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: human, mouse, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31168 Product name: Recombinant human RPGRIP1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of NM_015272 Sequence: MSGPTDETAGDLPVKDTGLNLFGMGGLQETSTTRTMKSRQAVSRVSREELEDRFLRLHDENILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVHELEKQNETLKNRLISAKQQL Predict reactive species\nFull Name: RPGRIP1-like\nCalculated Molecular Weight: 151 kDa\nObserved Molecular Weight: 151 kDa\nGenBank Accession Number: NM_015272\nGene Symbol: RPGRIP1L\nGene ID (NCBI): 23322\nRRID: AB_2923607\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q68CZ1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869427650729,"sku":"29778-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29778-1-ap","provider":"Iright","version":"1.0","type":"link"}