{"product_id":"proteintech-29784-1-ap","title":"Proteintech, 29784-1-AP, MPZL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MPZL1 (29784-1-AP) by Proteintech is a Polyclonal antibody targeting MPZL1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n29784-1-AP targets MPZL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  human placenta tissue,  mouse kidney tissue,  mouse liver tissue,  rat kidney tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMyelin protein zero-like 1 (MPZL1, also known as PZR) is a transmembrane glycoprotein that promotes the migration of hepatocellular carcinoma cells and is involved in extracellular matrix-induced signal transduction (PMID: 16702974; 8912526). Phosphorylated MPZL1 was linked to the regulation of cell adhesion and migration (PMID: 24296779; 18378677; 12410637). The expression levels of MPZL1 were also associated with malignant features of ovarian cancer (PMID: 31233194).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31532 Product name: Recombinant human MPZL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-162 aa of BC007881 Sequence: SALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPV Predict reactive species\nFull Name: myelin protein zero-like 1\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC007881\nGene Symbol: MPZL1\nGene ID (NCBI): 9019\nRRID: AB_3669695\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95297\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868843364521,"sku":"29784-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29784-1-ap","provider":"Iright","version":"1.0","type":"link"}