{"product_id":"proteintech-29787-1-ap","title":"Proteintech, 29787-1-AP, NSUN7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NSUN7 (29787-1-AP) by Proteintech is a Polyclonal antibody targeting NSUN7 in WB, ELISA applications with reactivity to human, mouse, rat samples\n29787-1-AP targets NSUN7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNSUN7 (NOP2\/Sun RNA methyltransferase family member 7) is involved in mitochondrial rRNA processing in post-meiotic sperm and is predicted to act upstream of or within flagellated sperm motility and sperm mitochondrion organization. In humans, Nsun7 encodes a protein with 718-amino acid and 3697-bp belonging to the methyltransferase superfamily (PMID: 37173708). The failure to produce NSUN7 would lead to the impairment in activity and motility of sperm flagella, leading to sperm motility deficit and infertility (PMID: 25702163).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31860 Product name: Recombinant human NSUN7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 332-475 aa of BC036568 Sequence: DPDLKTLFTKIGCKNIEILHEKFINIESKDHRLQKVKVILLLPRCSGLGVSNPVEFILNEHEDTEFLKDHSQGGISVDKLHVLAQQQYEQLTHAMKFTKAQAVVYCTCSVFPEENEAVVKKALEFQDLGNKGQPYSGTLLRQCL Predict reactive species\nFull Name: NOL1\/NOP2\/Sun domain family, member 7\nCalculated Molecular Weight: 718 aa, 81 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC036568\nGene Symbol: NSUN7\nGene ID (NCBI): 79730\nRRID: AB_2923609\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NE18\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887743094953,"sku":"29787-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29787-1-ap","provider":"Iright","version":"1.0","type":"link"}