{"product_id":"proteintech-29795-1-ap","title":"Proteintech, 29795-1-AP, Claudin 7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Claudin 7 (29795-1-AP) by Proteintech is a Polyclonal antibody targeting Claudin 7 in IHC, ELISA applications with reactivity to Human samples\n29795-1-AP targets Claudin 7 in WB, IHC, IF, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon tissue, mouse colon tissue,  human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nClaudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 27 claudins have been identified. They are small (20-27 kilodalton (kDa))  proteins with very similar structure. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31706 Product name: Recombinant human CLDN7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 150-211 aa of BC001055 Sequence: NPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV Predict reactive species\nFull Name: claudin 7\nCalculated Molecular Weight: 22.4 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC001055\nGene Symbol: Claudin 7\nGene ID (NCBI): 1366\nRRID: AB_2935481\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95471\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869525299369,"sku":"29795-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29795-1-ap","provider":"Iright","version":"1.0","type":"link"}