{"product_id":"proteintech-29798-1-ap","title":"Proteintech, 29798-1-AP, NOM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NOM1 (29798-1-AP) by Proteintech is a Polyclonal antibody targeting NOM1 in WB, IHC, ELISA applications with reactivity to Human, mouse samples\n29798-1-AP targets NOM1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, MCF-7 cells,  SW 1990 cells\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNucleolar protein NOM1, which contains an MIF4G domain and an MA3 domain, was first isolated from the bone marrow of children with acute myeloid leukemia. NOM1 is highly conserved in a variety of species, including in yeast and in humans.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31423 Product name: Recombinant human NOM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of NM_138400 Sequence: MAASRSAGEAGPGGSQGRVVRMKRRGGRGPRRGPAGGGEKALKRLKLAVEEFVHATSEGEAPGGCEGRGAPVSFRPGGRKSRKELRKEKRHLRKARRLQRTAGPEQGPGLGGRSGAEEASGHRQDTEERARPAPSRDPSPPRKPRPSRVKAKATAATAKTRPSAAATAAARKRALLAANEEEDREIRKLERCLGLNKRKKKDGSS Predict reactive species\nFull Name: nucleolar protein with MIF4G domain 1\nCalculated Molecular Weight: 96KD\nObserved Molecular Weight: 96~100 kDa\nGenBank Accession Number: NM_138400\nGene Symbol: NOM1\nGene ID (NCBI): 64434\nRRID: AB_3086164\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5C9Z4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887740014761,"sku":"29798-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29798-1-ap","provider":"Iright","version":"1.0","type":"link"}