{"product_id":"proteintech-29817-1-ap","title":"Proteintech, 29817-1-AP, CCDC39 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCDC39 (29817-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC39 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n29817-1-AP targets CCDC39 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCDC39 (Coiled-coil domain-containing protein 39) is an axonemal protein whose absence results in failure to correctly assemble DNALI1-containing inner dynein arm complexes, the DRC (dynein regulatory complex) and the radial spokes, thereby causing axonemal disorganization and dyskinetic beating. Alternatively, CCDC39 could participate in the transport of the inner dynein arms and DRC (PMID: 21131972). Its calculated molecular weight and observed molecular weight are both 110kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31067 Product name: Recombinant human CCDC39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-172 aa of NM_181426 Sequence: ANEENKLLEDQLSKLKDERASLQDELREYEERINSMTSHFKNVKQELSITQSLCKARERETESEEHFKAIAQRELGRVKDEIQRLENEMASILEKKSDKENGIFKATQKLDGLKCQMNWDQQALEAWLEESAHKDSDALTLQKYAQQDDNKIR Predict reactive species\nFull Name: coiled-coil domain containing 39\nCalculated Molecular Weight: 110 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: NM_181426\nGene Symbol: CCDC39\nGene ID (NCBI): 339829\nRRID: AB_3086172\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UFE4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885954814121,"sku":"29817-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29817-1-ap","provider":"Iright","version":"1.0","type":"link"}