{"product_id":"proteintech-29818-1-ap","title":"Proteintech, 29818-1-AP, RAB3IP\/Rabin8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB3IP\/Rabin8 (29818-1-AP) by Proteintech is a Polyclonal antibody targeting RAB3IP\/Rabin8 in WB, IP, ELISA applications with reactivity to human samples\n29818-1-AP targets RAB3IP\/Rabin8 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, A431 cells,  HeLa cells,  Jurkat cells\nPositive IP detected in: Jurkat cells, HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB3IP, also hnown as Rabin8, is a deduced 476-amino acid protein containing a central coiled-coil domain, a bipartite nuclear localization signal, and a C-terminal endoplasmic reticulum retention motif. Rabin8 has several sites for N-glycosylation and phosphorylation. Rabin8 plays important roles in various cellular processes, including ciliogenesis.The GEF activity of Rabin8 towards Rab8 is essential for ciliogenesis and cyst apical membrane transport,but not for exocytosis of discoidal\/fusiform-shaped vesicles.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31291 Product name: Recombinant human RABIN8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-192 aa of BC015548 Sequence: LPGGKTPFKKGHTRNKSTSSAMSGSHQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSS Predict reactive species\nFull Name: RAB3A interacting protein (rabin3)\nCalculated Molecular Weight: 476 aa, 53 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC015548\nGene Symbol: RAB3IP\nGene ID (NCBI): 117177\nRRID: AB_3669697\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96QF0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887778386089,"sku":"29818-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29818-1-ap","provider":"Iright","version":"1.0","type":"link"}