{"product_id":"proteintech-29819-1-ap","title":"Proteintech, 29819-1-AP, CX3CR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CX3CR1 (29819-1-AP) by Proteintech is a Polyclonal antibody targeting CX3CR1 in WB, IF-P, ELISA applications with reactivity to human, mouse samples\n29819-1-AP targets CX3CR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, SH-SY5Y cells,  THP-1 cells,  Caco-2 cells\nPositive IF-P detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCX3CR1, also known as GPR13, V28 and fractalkine receptor, belongs to the 7-transmembrane G protein-coupled receptor (GPCR) family. It is expressed on microglia, astrocytes, NK cells, monocytes\/macrophages, and a subpopulation of T cells. CX3CR1 is the receptor for fractalkine (CX3CL1) and mediates both its adhesive and migratory functions. It also acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro), and some variations in the gene of CX3CR1 lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Defects in CX3CR1 are a cause of susceptibility to age-related macular degeneration type 12 (ARMD12). The two CX3CR1 bands exhibited can be attributed to various factors (PMID: 30628679).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27698 Product name: Recombinant human CX3CR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 56-231 aa of BC028078 Sequence: LTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIK Predict reactive species\nFull Name: chemokine (C-X3-C motif) receptor 1\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 40 kDa, 44 kDa\nGenBank Accession Number: BC028078\nGene Symbol: CX3CR1\nGene ID (NCBI): 1524\nRRID: AB_3086173\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49238\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869528871081,"sku":"29819-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29819-1-ap","provider":"Iright","version":"1.0","type":"link"}