{"product_id":"proteintech-29824-1-ap","title":"Proteintech, 29824-1-AP, CCDC111\/PRIMPOL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCDC111\/PRIMPOL (29824-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC111\/PRIMPOL in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human samples\n29824-1-AP targets CCDC111\/PRIMPOL in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  HepG2 cells,  HeLa cells,  Jurkat cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCDC111, also known as PRIMPOL, FLJ33167, which contains the active-site motifs of AEP primases and a putative Zn finger similar to that of herpesvirus UL52 primase and other AEP-like enzymes. CCDC111 is required to facilitate mitochondrial and nuclear replication fork progression by initiating de novo DNA synthesis using dNTPs and acting as an error-prone DNA polymerase able to bypass certain DNA lesions (PMID: 24126761, PMID: 24207056). In addition to its role in DNA damage response, also required to maintain efficient nuclear and mitochondrial DNA replication in unperturbed cells (Uniprot, PMID: 30715459).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31478 Product name: Recombinant human CCDC111 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 305-560 aa of BC064600 Sequence: EVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFSDTLRILTCEPSQNKQKGVGYFNSIGTSVETIEGFQCSPYPEVDHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEVWYQKCHDPVCKAENFKSDCFPLPAEVCLLFLFKEEEEFTTDEADETRSNETQNPHKPSPSRLSTGASADAVWDNGIDDAYFLEATEDAELAEAAENSLLSYNSEVDEIPDELIIEVLQE Predict reactive species\nFull Name: coiled-coil domain containing 111\nObserved Molecular Weight: 64 kDa\nGenBank Accession Number: BC064600\nGene Symbol: CCDC111\/PRIMPOL\nGene ID (NCBI): 201973\nRRID: AB_2918349\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96LW4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868881211561,"sku":"29824-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29824-1-ap","provider":"Iright","version":"1.0","type":"link"}