{"product_id":"proteintech-29846-1-ap","title":"Proteintech, 29846-1-AP, STK24 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STK24 (29846-1-AP) by Proteintech is a Polyclonal antibody targeting STK24 in WB, IHC, ELISA applications with reactivity to Human,  mouse,  rat samples\n29846-1-AP targets STK24 in WB, IHC, ELISA applications and shows reactivity with Human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse lung tissue,  HeLa cells,  Jurkat cells,  rat lung tissue,  rat skin tissue,  rat spleen tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSerine\/threonine-protein kinase 24 (STK24), also named MST3, belonging to GCK subfamily of STE20-like kinases, acts on both serine and threonine residues and promotes apoptosis in response to stress stimuli and caspase activation (PubMed: 10644707, PMID:12107159). STK24 and STK25 operate in the same cardiovascular development pathway with programmed cell death 10 (CCM3) (PMID: 20332113). It regulates axon outgrowth in forebrain neurons (PubMed: 17114295).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31519 Product name: Recombinant human STK24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 320-443 aa of NM_003576 Sequence: SDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH Predict reactive species\nFull Name: serine\/threonine kinase 24 (STE20 homolog, yeast)\nCalculated Molecular Weight: 49KD\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: NM_003576\nGene Symbol: STK24\nGene ID (NCBI): 8428\nRRID: AB_2923614\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6E0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887818100905,"sku":"29846-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-29846-1-ap","provider":"Iright","version":"1.0","type":"link"}